-
1 moisture sensitivity
Автомобильный термин: чувствительность к влаге -
2 moisture sensitivity
English-russian automobile dictionary > moisture sensitivity
-
3 moisture sensitivity
Англо-русский словарь по машиностроению > moisture sensitivity
-
4 moisture
влажность; сырость; влага- moisture of fuel as received - moisture-proof - moisture-repellant - moisture-resistant - moisture sensitivity - moisture test - final soil moisture content - initial soil moisture content -
5 MSL
1) Компьютерная техника: Marvel Strategy Language, Model Specification Language2) Авиация: средний уровень моря (AD)3) Морской термин: Maximum Securing Load (a term used to define the allowable load capacity for a device used to secure cargo to a ship)4) Американизм: Minimum Subsistence Level5) Спорт: Mechanized Skirmish League, Mid State League6) Военный термин: Military School of Languages, maintenance supply liaison, manpower source listing, master support list, maximum service life, measurement standards laboratory, military shipping label, military support list7) Техника: main steamline, maximum still-water level8) Шутливое выражение: Mew's Secret Land, Mews Secret Land9) Математика: медианный уровень значимости (median significance level)10) Сокращение: Manned Space Laboratory, Master of Sciences in Linguistics, Mean Sea Level, Moisture Sensitivity Level11) Электроника: Modify system logging12) Вычислительная техника: Microsoft Software Library (Internet, MS), Maximum Segment Lifetime (TCP/IP)13) Нефть: M sea level, максимальный срок службы (maximum service life)14) Космонавтика: materials science laboratory15) Фирменный знак: Marks Spencer Lingerie16) Глоссарий компании Сахалин Энерджи: СУМ (Mean Sea Level)17) Образование: Multi Sensory Learning18) Сетевые технологии: Mirrored Server Link, manufacturer suggested list price, канал связи зеркально отображаемых серверов, канал связи отражённых серверов19) Автоматика: Modicon State Language20) Медицинская техника: Measurement Server Link (Philips)21) Расширение файла: Map Specification Library22) Нефть и газ: MV scale low limit, medium sea level, scale low limit for MV23) Аэропорты: Muscle Shoals, Alabama USA24) Парашютный спорт: уровень моря -
6 msl
1) Компьютерная техника: Marvel Strategy Language, Model Specification Language2) Авиация: средний уровень моря (AD)3) Морской термин: Maximum Securing Load (a term used to define the allowable load capacity for a device used to secure cargo to a ship)4) Американизм: Minimum Subsistence Level5) Спорт: Mechanized Skirmish League, Mid State League6) Военный термин: Military School of Languages, maintenance supply liaison, manpower source listing, master support list, maximum service life, measurement standards laboratory, military shipping label, military support list7) Техника: main steamline, maximum still-water level8) Шутливое выражение: Mew's Secret Land, Mews Secret Land9) Математика: медианный уровень значимости (median significance level)10) Сокращение: Manned Space Laboratory, Master of Sciences in Linguistics, Mean Sea Level, Moisture Sensitivity Level11) Электроника: Modify system logging12) Вычислительная техника: Microsoft Software Library (Internet, MS), Maximum Segment Lifetime (TCP/IP)13) Нефть: M sea level, максимальный срок службы (maximum service life)14) Космонавтика: materials science laboratory15) Фирменный знак: Marks Spencer Lingerie16) Глоссарий компании Сахалин Энерджи: СУМ (Mean Sea Level)17) Образование: Multi Sensory Learning18) Сетевые технологии: Mirrored Server Link, manufacturer suggested list price, канал связи зеркально отображаемых серверов, канал связи отражённых серверов19) Автоматика: Modicon State Language20) Медицинская техника: Measurement Server Link (Philips)21) Расширение файла: Map Specification Library22) Нефть и газ: MV scale low limit, medium sea level, scale low limit for MV23) Аэропорты: Muscle Shoals, Alabama USA24) Парашютный спорт: уровень моря -
7 test
1. испытание, тест2. проверка, оценка4. проба5. испытывать, проверять (see also testing)6. пробоватьabrasion test — 1) испытание на истирание [абразивный износ] 2) испытание царапанием
abrasive hardness test — 1) склерометрическое испытание на твёрдость 2) склерометрическое определение твёрдости
abruption test — испытание на разрыв
absorption test — испытание на поглощение, определение влагостойкости
accelerated test — 1) ускоренное [сокращённое] испытание 2) экспресс-анализ
acceleration test — испытание на воздействие ускорений
acid-proof test — испытание на кислотостойкость
adhesion test — испытание на адгезию [прочность сцепления], испытание прочности склейки
adhesive test — испытание прочности склейки, испытание на адгезию [прочность сцепления]
adiabatic-compression sensitivity test — испытание на чувствительность ( ракетного топлива) к адиабатическому сжатию
aging test — испытание на старение
air test — 1) испытание в воздушной среде 2) испытание на герметичность 3) испытание сжатым воздухом
alkali-proof test — испытание на щёлочестойкость
alternate-stress test — испытание ( на усталость) знакопеременной нагрузкой
alternating-bending test — испытание на знакопеременный изгиб
antiseptic test — испытание на антисептичность
artificial aging test — испытание на искусственное [ускоренное] старение
atmospheric stress corrosion test — испытание на коррозию под напряжением в атмосферных условиях
attrition test — испытание на износ
ball hardness test — испытание твёрдости вдавливанием шарика, определение твёрдости по Бринелю
indentation pressure test — определение твёрдости по Бринелю, испытание твёрдости вдавливанием шарика
bearing test — испытание на смятие [опорную прочность]
bending test — испытание на изгиб
bend-over test — испытание на изгиб
biaxial tension test — испытание на двухосное растяжение
bird impact test — испытание на пробой тушками птиц
blow test — 1) испытание на удар 2) испытание на ударную прочность
bond test — испытание на сцепление
bonding peel test — испытание на отслаивание склейки
breaking test — 1) испытание на разрушение, испытание на разрыв 2) испытание на излом
breakdown test — 1) испытание на разрушение, испытание на разрыв 2) испытание на излом
Brinell-hardness test — определение твёрдости по Бринелю
brittleness test — испытание на ломкость [хрупкость]
buckling test — испытание на продольный изгиб
bulk dilution test — испытание па всестороннее сжатие
bump test — 1) ударное испытание 2) испытание на ударную прочность
burning test — испытание на горение [горючесть]
burn-off test — испытание выжиганием ( для определения состава связующего)
bursting test — испытание с разрушением образца
cavitation test — испытание на кавитацию
Charpy impact test — испытание на удар по Шарпи, определение ударной вязкости по Шарпи
Charpy V-notch test — определение ударной вязкости образца с V-образным надрезом по Шарпи
charring ablator test — испытание обугливающегося [коксующегося] абляционного материала
chemical test — 1) химическое испытание 2) химический анализ
cleavage test — испытание на расщепление
climatic test — климатическое испытание, испытание на воздействие климатических условий
cold temperature test — испытание на морозостойкость, испытание при низких температурах
combustibility test — испытание на воспламенение [горючесть]
compatibility test — испытание на совместимость
complete destructive test — полное разрушающее испытание
composite test — испытание композиционного материала
compression test — испытание на сжатие
constant load test — испытание при постоянной нагрузке
corrosion test — испытание коррозионностойкости, коррозионное испытание
corrosion fatigue test — испытание на коррозионную усталость
corrosive wear test — испытание на окислительный износ
cracking test — коррозионное испытание на растрескивание
crack-propagation test — испытание на распространение трещин
crash test — испытание на разрушение
creep test — 1) испытание на ползучесть 2) испытание на текучесть
creep-rupture test — испытание на длительную прочность
cripling test — 1) испытание на продольный изгиб 2) испытание на перегиб
critical collapse test — испытание на устойчивость
cross-bending test — испытание на поперечный изгиб
crushing test — 1) испытание на раздавливание 2) испытание на раздробление
cryogenic temperature test — испытание при криогенных [низких] температурах
cupping test — испытание на вытяжку
curing test — испытание на вулканизацию
cycle test — циклическое испытание
cyclic test — циклическое испытание
cycle humidity test — циклическое испытание во влажной среде
cyclic-oxidation test — испытание на циклическое окисление
damping test — 1) испытание демпфирующих свойств 2) испытание на циклическую вязкость
deep-drawing test — испытание на глубокую вытяжку
deflection test — испытание на изгиб [прогиб]
deformation test — испытание на деформацию
delamination test — испытание на отслаивание
destruction test — испытание с разрушением ( образца)
destructive test — испытание с разрушением ( образца)
diamond-pyramide hardness test — определение твёрдости вдавливанием алмазной пирамиды ( по Виккерсу)
dielectric test — испытание диэлектрика [диэлектрических свойств]
direct compression test — испытание на двустороннее сжатие
drifting test — испытание на пробиваемость
drop-weight test — 1) испытание на удар падающим грузом 2) ударное испытание 3) определение ударной вязкости 4) копровое испытание
drop-weight tear test — ударное испытание на разрыв
dry strand test — испытание сухой пряди
ductile test — 1) испытание на вязкость 2) определение ударной вязкости
durability test — испытание на выносливость [долговечность]
dye-penetrant test — испытание методом красок, контроль проникающими красками
dynamic corrosion test — динамическое испытание на коррозию
elasticity test — испытание на упругость [эластичность]
electrolytic corrosion test — 1) испытание на электрохимическую коррозию 2) испытание электролита на коррозию
elevated-temperature test — испытание при повышенных температурах
elongation test — испытание на удлинение [растяжение]
endurance test — 1) испытание на выносливость [усталость] 2) испытание на прочность [стойкость] (например, лака или краски)
endurance tension test — испытание на выносливость при растяжении
endurance torsion test — испытание на выносливость при кручении
environmental test — испытание на воздействие окружающей среды
erosion test — испытание на эрозию
etching test — 1) испытание травлением 2) проба ( металла) травлением
explosive loading test — испытание взрывом, взрывное испытание
external hydrostatic test — испытание на внешнее гидростатическое давление
external pressure test — испытание на внешнее давление
falling ball test — испытание на упругость методом падающего шарика
falling sphere test — испытание на упругость методом падающего шарика
fatigue test — испытание на усталость [выносливость]
final test — испытание до разрушения
fire test — 1) испытание на огнестойкость 2) определение температуры воспламенения 3) огневое испытание ( двигателя)
fire-resistance test — испытание на огнестойкость
flammability test — испытание на воспламеняемость
flash test — определение температуры вспышки, испытание на воспламенение
flat-bending test — испытание на плоский изгиб
flattening test — испытание на сплющивание
flexural impact test — ударное испытание на изгиб
flexure test — испытание на изгиб
fluorescent test — флуоресцентный [люминесцентный] контроль
forging test — испытание на ковкость
fracture test — испытание на излом [разрушение]
freezing test — испытание на замораживание [морозостойкость]
friability test — испытание на хрупкость [ломкость]
friction test — испытание на трение
fuel-resistance test — испытание на топливостойкость
fungus test — испытание на грибостойкость
gamma-ray test — просвечивание гамма-лучами, гаммаграфический контроль
gas impermeability test — испытание на газонепроницаемость
gasoline-resistance test — испытание на бензиностойкость
gas permeability test — испытание на газопроницаемость
hammering test — испытание на ковкость
hanging test — испытание на разрыв подвешиванием грузов к образцу
hardenability test — проба на прокаливаемость
hardness test — испытание на твёрдость, определение твёрдости
heat test — испытание нагревом [на нагрев]
heat-resistance test — испытание на теплостойкость
heat-stability test — испытание на термическую устойчивость
high-pressure test — испытание при высоких давлениях
high-temperature test — 1) испытание на жаростойкость 2) испытание при высоких температурах
high-voltage test — испытание на выносливость высокого напряжения (например, изоляции)
horizontal shear test — испытание на сдвиг [срез] вдоль слоёв
hot test — 1) испытание в горячем состоянии, горячая проба 2) испытание на нагрев
humidity test — испытание во влажной среде
hydraulic pressure test — гидравлическое испытание
hydraulic tension ring test — гидравлическое испытание колец на растяжение
hydrostatic test — гидростатическое испытание
hysteresis test — испытание на гистерезис
immersion test — 1) испытание погружением образца 2) иммерсионный контроль
impact test — 1) испьггание на ударные нагрузки 2) испытание на удар 3) ударное испытание 4) определение ударной вязкости
indentation test — испытание на твёрдость вдавливанием (например, шарика или пирамиды)
insulation test — 1) испытание на изоляцию 2) испытание изоляции
interlaminar shear test — испытание на межслойный сдвиг
interlaminar tensile test — испытание на межслойное растяжение
internal hydrostatic pressure test — испытание на внутреннее гидростатическое давление
Knoop hardness test — испытание на микротвёрдость по Кнупу, определение микротвёрдости по Кнупу
life test — испытание на долговечность
light aging test — испытание на световое старение
light resistance test — испытание на светостойкость
loading test — статическое испытание, испытание нагружением
long-duration test — длительное испытание
long-time creep test — испытание на длительную прочность
low-temperature test — испытание при низких [криогенных] температурах, испытание на морозостойкость
magnetic test — магнитный контроль [дефектоскопия]
magnetic fluid test — магнитный контроль методом суспензии
magnetic particle test — контроль магнитными частицами
magnetic permeability test — испытание на магнитную проницаемость
magnetic perturbation test — контроль методом магнитного возмущения
magnetic powder test — магнитный контроль методом порошков, дефектоскопия магнитным порошком
mechanical test — испытание механических свойств, механические испытания
metallographic test — металлографическое исследование
meteorite-strike test — испытание на пробой [удар] метеоритами
micrograph test — металлографическое исследование
microhardness test — испытание на микротвёрдость, определение микротвёрдости
moisture absorption test — испытание на влагопоглощение
moisture permeability test — испытание на водопроницаемость
moisture-proofness test — испытание на влагостойкость [влагонепроницаемость]
moisture-resistance test — испытание на влагонепроницаемость [влагостойкость]
Mooney viscosity test — определение вязкости по Муни
Naval Ordnance Laboratory ring test — испытание кольцевых образцов по методу лаборатории вооружения ВМС США, испытание колец NOL
NOL ring test — испытание колец NOL, испытание кольцевых образцов по методу лаборатории вооружения ВМС США
NOL multiaxial fatigue test — многоосное испытание колец NOL на усталость
nondestructive test — 1) испытание без разрушения ( образца) 2) неразрушающий контроль
notched-bar impact test — испытание на удар надрезанного образца, определение ударной вязкости надрезанного образца
notched bend test — испытание на изгиб надрезанного образца
notched tensile test — испытание на разрыв надрезанного образца
notch shock test — испытание на ударную вязкость надрезанного образца
odor test — 1) испытание на запах 2) проба на запах
oil-resistance test — испытание на маслостойкость
outdoor exposure test — испытание [выдержка] на открытом воздухе
oven test — испытание на тепловое старение в печи
oxidation test — испытание на окисление
oxygen bomb test — испытание на искусственное старение в кислородной бомбе
ozone aging test — испытание на старение в озоне
peeling test — 1) испытание на отслаивание 2) испытание на отрыв
pendulum impact test — испытание на удар маятниковым копром
penetrant fluid test — контроль проникающей жидкостью
penetrant nondestructive test — контроль проникающим веществом без разрушения ( образца)
performance test — 1) испытание в эксплуатационных условиях 2) определение характеристик ( материала)
plasma torch test — испытание плазменной горелкой
plasticity test — 1) испытание на пластичность 2) определение пластичности
pliability test — 1) определение пластичности 2) испытание на пластичность
plastic range test — определение пределов пластичности
ply separation test — испытание на расслоение [отслоение]
porosity test — проба на пористость ( травлением)
pulling test — испытание на растяжение [разрыв]
pulsed eddy-current test — 1) проверка импульсными вихревыми токами 2) электроиндуктивная дефектоскопия
pure-bending test — испытание на чистый изгиб
qual test — испытание на соответствие техническим условиям
qualification test — испытание на соответствие техническим условиям
quenching test — проба на прокаливаемость
quick test — ускоренное испытание, экспресс-анализ
radiant-heating test — испытание на лучистый нагрев
radiation test — радиационное испытание
radiographic test — 1) радиографический контроль 2) рентгенографический контроль 3) гаммаграфический контроль
rebound test — испытание на эластичность по отскоку
reliability test — испытание на надёжность
repeated compression test — испытание на усталость при многократных сжатиях
repeated impact test — испытание на динамическую выносливость
repeated stress test — испытание на усталость [выносливость] при повторных нагрузках
repeated tension test — испытание на многократное растяжение
resin test — 1) испытание смолы 2) испытание связующего
reverse bending test — испытание на знакопеременный изгиб
ring test — кольцевое испытание, испытание кольцевого образца
Rockwell hardness test — определение твёрдости по Роквеллу
room-temperature burst test — разрывное испытание при комнатной температуре
room-temperature cycle test — циклическое испытание при комнатной температуре
rotational drop test — испытание на маятниковом копре
rupture test — испытание на разрушение [разрыв, прочность]
safe-life test — испытание на безопасный срок хранения ( ракетного топлива)
scleroscope hardness test — определение твёрдости по склероскопу, склероскопическое испытание на твёрдость
scratch hardness test — испытание на твёрдость царапанием, определение твёрдости по Моосу
separation test — испытание на расслоение
service test — испытание в эксплуатационных условиях, эксплуатационное испытание
shearing test — испытание на сдвиг [срез, скалывание]
shock test — испытание на удар, ударное испытание
shock-bending test — испытание на изгиб ударом
Shore indentional test — определение твёрдости по Шору
Shore scleroscope test — определение твёрдости по Шору
short-time test — кратковременное испытание, экспресс-испытание, экспресс-анализ
sieve test — ситовый анализ
sieving test — ситовый анализ
simulated environment test — испытание в условиях, имитирующих окружающую среду
simulated space test — испытание в условиях, имитирующих космические
sintering test — испытание на спекаемость
size test — гранулометрический анализ
sizing test — гранулометрический анализ
sonic test — испытание ультразвуковым методом
space test — испытание в космических условиях
specific-gravity test — определение удельного веса
standard test — 1) стандартное [типовое] испытание 2) стандартная проба
static test — статическое испытание
static-fatigue test — статическое испытание на усталость
static notched bend test — статическое испытание на изгиб надрезанного образца
static vibration test — статическое испытание на вибрацию
stiffness test — испытание на жёсткость
strain-cycling test — испытание методом циклического деформирования
strength test — 1) испытание па прочность 2) определение временного сопротивления
stress-corrosion test — испытание на коррозию под напряжением
stress-durability test — испытание на длительную прочность [статическую усталость]
stress relaxation test — испытание на релаксацию напряжений
stretching test — испытание на растяжение [сопротивление разрыву], испытание на удлинение при разрыве
strip peel test — испытание на отслаивание ленты
structural test — испытание на прочность
tearing test — 1) испытание на разрыв [раздир] 2) испытание на износ
temperature test — температурное испытание, испытание на нагрев
tenacity test — 1) испытание на разрыв 2) испытание на растяжение 3) испытание на вязкость [прилипание]
tensile test — 1) испытание на разрыв 2) испытание на растяжение
tensile fatigue test — испытание на усталость при растяжении
tensile impact test — 1) ударное испытание на разрыв 2) ударное испытание на растяжение
tensile shock test — 1) ударное испытание на растяжение 2) ударное испытание на разрыв
tensile strength test — определение временного сопротивления на растяжение, испытание на разрыв
tension test — 1) испытание на растяжение 2) определение диаграммы растяжения
tension fatigue test — испытание на усталость при растяжении
thermal test — тепловое [термическое] испытание
thermal fatigue test — испытание на термическую усталость, термоциклическое испытание
thermal shock test — испытание на тепловой удар
thermomechanical test — термомеханическое испытание
torque test — испытание на кручение [скручивание]
torsional test — испытание на скручивание [кручение]
torsion shear test — испытание на срез при скручивании
toughness test — испытание на ( ударную) вязкость
tracer test — испытание методом меченых атомов
transverse-bending test — испытание на поперечный изгиб
twisting test — испытание на кручение [скручивание]
uniaxial shear test — испытание на чистый сдвиг
uniaxial tensile test — испытание на одноосное растяжение
uninflammability test — испытание на невоспламеняемость
unnotched tensile test — испытание на разрыв ненадрезанного образца
upsetting test — испытание на раздачу ( труб)
vacuum test — испытание в вакууме
vibration test — испытание на вибрацию [вибропрочность]
vibroacoustic test — виброакустическое испытание
Vickers diamond-pyramide hardness test — определение твёрдости вдавливанием алмазной пирамиды по Виккерсу
Vickers hardness test — испытание на твёрдость по Виккерсу, определение твёрдости по Виккерсу
viscosity test — испытание на вязкость, определение вязкости, реологическое испытание
V-notch test — испытание образца с V-образным надрезом
V-notch impact test — испытание на удар образца с V-образным надрезом
waterproof test — испытание на водостойкость
wearing test — 1) испытание на износ 2) испытание на истирание
weathering test — 1) испытание на старение в атмосферных условиях 2) испытание на погодостойкость
weatherproof test — 1) испытание на погодостойкость 2) испытание на атмосферную коррозию
weight-loss test — испытание на коррозию по убыли веса образца
weldability test — испытание на свариваемость
welding test — испытание на свариваемость
X-ray test — 1) рентгеновское [рентгеноскопическое] испытание 2) рентгеновский [рентгенографический] анализ
English-Russian dictionary of aviation and space materials > test
-
8 characteristic
1) свойство, признак2) характеристика; мн. ч. технические данные; параметры3) кривая•-
absolute spectral-response characteristic
-
acceleration characteristic of fuel
-
acceleration characteristic
-
acceptable water characteristic
-
adsorption-desorption characteristic of catalyst
-
aerodynamic characteristics
-
aerolastic characteristics
-
aging characteristics
-
air flow characteristic
-
aircraft performance characteristics
-
amplitude-versus-frequency response characteristic
-
amplitude-frequency response characteristic
-
amplitude-versus-frequency characteristic
-
amplitude-frequency characteristic
-
amplitude-phase characteristic
-
anode characteristic
-
attenuation characteristic
-
availability characteristic
-
background response characteristic
-
baking characteristic
-
B-H characteristic
-
bonding characteristics
-
brake response characteristic
-
braking characteristic
-
bread-making characteristic
-
breakdown characteristic
-
brittle-fracture characteristic
-
camera spectral-sensitivity camera-taking characteristics
-
camera spectral camera-taking characteristics
-
camera spectral-sensitivity characteristics
-
camera spectral characteristics
-
casting characteristics
-
cathode characteristic
-
charge characteristic
-
chromatic characteristic
-
cleaning characteristics
-
coking characteristics
-
color characteristic
-
color photographic characteristics
-
comparison characteristics
-
constant-current characteristic
-
continuous cooling transformation characteristics
-
control characteristic
-
cooking characteristics
-
corrosive characteristics
-
crack propagation characteristic
-
cracking characteristic of catalyst
-
creep characteristic
-
current-illumination characteristic
-
current-voltage characteristic
-
cutoff characteristic
-
cutoff current characteristic
-
damping characteristic
-
dc characteristic
-
decay characteristic
-
design characteristics
-
detonation characteristic
-
diode characteristic
-
directional characteristic
-
discharge characteristic
-
discharge voltage-current characteristic
-
distillation characteristic
-
double-humped characteristic
-
drooping characteristic
-
dynamic characteristic
-
edibility characteristics
-
efficiency-concentration characteristic
-
E-I characteristic
-
elastic characteristics
-
electrode characteristic
-
elevation characteristics
-
emission characteristic
-
engine full-load characteristics
-
envelope delay characteristic
-
etching characteristic
-
exposure characteristics
-
fail-safe characteristics
-
falling characteristic
-
fatigue characteristic
-
feedback characteristic
-
filtration characteristic of catalyst
-
flashover characteristic
-
flight characteristics
-
flow characteristics
-
fluidizing characteristics
-
forward characteristic
-
frequency-response characteristic
-
frequency characteristic
-
friction gearing pull characteristic
-
frictional characteristic of lubricants
-
fuel gravity characteristics
-
full-load characteristic
-
fusibility characteristic
-
gain characteristic
-
gain-frequency characteristic
-
gain-phase characteristic
-
gain-transfer characteristic
-
gamma characteristic
-
gray-tone characteristic
-
grid characteristic
-
grid-drive characteristic
-
group-delay characteristic
-
handling characteristic
-
hardening characteristics
-
heat transfer characteristic
-
high-temperature stress-rupture characteristic
-
holographic characteristics
-
hysteresis characteristic
-
impedance-frequency characteristic
-
impedance characteristic
-
input characteristic
-
knock characteristic of gasoline
-
lag characteristic
-
landing characteristics
-
light-transfer characteristic
-
linear characteristic
-
load characteristic
-
longevity propagation characteristic
-
luminous characteristic
-
luminous-resistance characteristic
-
machine characteristics
-
magnetic characteristic
-
magnetization characteristic
-
mb characteristics
-
metering characteristic
-
milling characteristic
-
moisture discharge characteristic
-
noise characteristic
-
no-load characteristic
-
nozzle spray characteristic
-
numerical characteristic
-
open-circuit characteristic
-
operating characteristics
-
optimal characteristic
-
output characteristic
-
overload characteristics
-
oxidation characteristic
-
packing characteristic of polymer
-
performance characteristics
-
persistance characteristic
-
phase-response characteristic
-
phase characteristic
-
photographic characteristics
-
photovoltaic characteristic
-
plate characteristic
-
population characteristic
-
pore structure characteristic of catalyst
-
positive void characteristic
-
power characteristic of fuel
-
prearcing time/current characteristic
-
pressure drop characteristics
-
processing characteristics
-
propulsion performance characteristics
-
pulse-response characteristic
-
pulse characteristic
-
qualitative characteristic
-
quantitative characteristic
-
quantization characteristic
-
recovery characteristic
-
rectifying characteristic
-
reliability characteristic
-
resin leakage characteristics
-
resistance variation characteristic
-
resistance-temperature characteristic
-
resolving-power characteristics
-
resonance characteristic
-
response characteristic
-
reverse characteristic
-
running characteristics
-
sample characteristic
-
saturation characteristic
-
sensitometric characteristics
-
series characteristic
-
shatter characteristic
-
short-circuit characteristic
-
shunt characteristic
-
sloping characteristic
-
solidifying characteristics of oil
-
spectral characteristic
-
spectral-sensitivity characteristic
-
speed-torque characteristic
-
spin-recovery characteristics
-
square-wave response characteristic
-
stability characteristics
-
stalling characteristics
-
stall characteristics
-
start/stop characteristic
-
starting characteristic
-
static characteristic
-
steady-state characteristic
-
strain-hardening characteristic
-
strength characteristics
-
surge characteristic
-
swelling characteristic
-
switching characteristic
-
takeoff and landing characteristics
-
temperature characteristic
-
test-bench characteristics
-
thermal and physical characteristics
-
throttling characteristic
-
time characteristic
-
time-to-failure characteristic
-
timing characteristic
-
toughness characteristic
-
towing characteristic
-
track-defining characteristics
-
transfer characteristic
-
transient characteristic
-
transmission characteristic
-
tribological characteristics
-
tribometrical characteristics
-
tribotechnical characteristics
-
trim characteristics
-
trouble-free characteristic
-
turn characteristics
-
unitgraph characteristics
-
unwinding characteristic
-
user-definable characteristics
-
viscosity-temperature characteristic
-
voltage-current characteristic
-
voltage-time characteristic
-
wavelength characteristic
-
wear characteristics
-
well producing characteristics
-
work-hardening characteristic
-
working characteristics -
9 control
1) управление; регулирование || управлять; регулировать2) контроль || контролировать3) управляющее устройство; устройство управления; регулятор4) профессиональное мастерство, квалификация, техническая квалификация5) pl органы управления•"in control" — "в поле допуска" ( о результатах измерения)
to control closed loop — управлять в замкнутой системе; регулировать в замкнутой системе
- 2-handed controlsto control open loop — управлять в разомкнутой системе; регулировать в разомкнутой системе
- 32-bit CPU control
- acceptance control
- access control
- acknowledge control
- active process control
- adaptable control
- adaptive constraint control
- adaptive control for optimization
- adaptive control
- adaptive feed rate control
- adaptive quality control
- adjustable feed control
- adjustable rotary control
- adjustable speed control
- adjusting control
- adjustment control
- AI control
- air logic control
- analog data distribution and control
- analogical control
- analytical control
- application control
- arrows-on-curves control
- autodepth control
- autofeed control
- automated control of a document management system
- automated technical control
- automatic backlash control
- automatic control
- automatic editing control
- automatic gain control
- automatic gripper control
- automatic level control
- automatic process closed loop control
- automatic remote control
- automatic sensitivity control
- automatic sequence control
- automatic speed control
- automatic stability controls
- auxiliaries control
- balanced controls
- band width control
- bang-bang control
- bang-bang-off control
- basic CNC control
- batch control
- bibliographic control
- bin level control
- boost control
- built-in control
- button control
- cam control
- cam throttle control
- camshaft control
- carriage control
- Cartesian path control
- Cartesian space control
- cascade control
- C-axis spindle control
- cell control
- center control
- central control
- central supervisory control
- centralized control
- centralized electronic control
- central-station control
- changeover control
- chip control
- circumferential register control
- close control
- closed cycle control
- closed loop control
- closed loop machine control
- closed loop manual control
- closed loop numerical control
- closed loop position control
- clutch control
- CNC control
- CNC indexer control
- CNC programmable control
- CNC symbolic conversational control
- CNC/CRT control
- CNC/MDI control
- coarse control
- coded current control
- coded current remote control
- color control
- combination control
- command-line control
- compensatory control
- composition control
- compound control
- computed-current control
- computed-torque control
- computer control
- computer numerical control
- computer process control
- computer-aided measurement and control
- computer-integrated manufacturing control
- computerized control
- computerized numerical control
- computerized process control
- constant surface speed control
- constant value control
- contactless control
- contact-sensing control
- contamination control
- continuous control
- continuous path control
- continuous process control
- contour profile control
- contouring control
- conventional hardware control
- conventional numerical control
- conventional tape control
- convergent control
- conversational control
- conversational MDI control
- coordinate positioning control
- coordinate programmable control
- copymill control
- counter control
- crossed controls
- current control
- cycle control
- dash control
- data link control
- data storage control
- deadman's handle controls
- depth control
- derivative control
- dial-in control
- differential control
- differential gaging control
- differential gain control
- differential temperature control
- digital brushless servo control
- digital control
- digital position control
- digital readout controls
- dimensional control
- direct computer control
- direct control
- direct digital control
- direct numerical control
- direction control
- directional control
- dirt control
- discontinuous control
- discrete control
- discrete event control
- discrete logic controls
- dispatching control
- displacement control
- distance control
- distant control
- distributed control
- distributed numerical control
- distributed zone control
- distribution control
- dog control
- drum control
- dual control
- dual-mode control
- duplex control
- dust control
- dynamic control
- eccentric control
- edge position control
- EDP control
- electrical control
- electrofluidic control
- electromagnetic control
- electronic control
- electronic level control
- electronic speed control
- electronic swivel control
- elevating control
- emergency control
- end-point control
- engineering change control
- engineering control
- entity control
- environmental control
- error control
- error plus error-rate control
- error-free control
- external beam control
- factory-floor control
- false control
- feed control
- feed drive controls
- feedback control
- feed-forward control
- field control
- fine control
- finger-tip control
- firm-wired numerical control
- fixed control
- fixed-feature control
- fixture-and-tool control
- flexible-body control
- floating control
- flow control
- fluid flow control
- follow-up control
- foot pedal control
- force adaptive control
- forecasting compensatory control
- fork control
- four quadrant control
- freely programmable CNC control
- frequency control
- FROG control
- full computer control
- full order control
- full spindle control
- gage measurement control
- gain control
- ganged control
- gap control
- gear control
- generative numerical control
- generic path control
- geometric adaptive control
- graphic numerical control
- group control
- grouped control
- guidance control
- hairbreath control
- hand control
- hand feed control
- hand wheel control
- hand-held controls
- handle-type control
- hand-operated controls
- hardened computer control
- hardwared control
- hardwared numerical control
- heating control
- heterarchical control
- hierarchical control
- high-integrity control
- high-level robot control
- high-low control
- high-low level control
- high-technology control
- horizontal directional control
- humidity control
- hybrid control
- hydraulic control
- I/O control
- immediate postprocess control
- inching control
- in-cycle control
- independent control
- indexer control
- indirect control
- individual control
- industrial processing control
- industrial-style controls
- infinite control
- infinite speed control
- in-process control
- in-process size control
- in-process size diameters control
- input/output control
- integral CNC control
- integral control
- integrated control
- intelligent control
- interacting control
- interconnected controls
- interlinking control
- inventory control
- job control
- jogging control
- joint control
- joystick control
- just-in-time control
- language-based control
- laser health hazards control
- latching control
- lead control
- learning control
- lever control
- lever-operated control
- line motion control
- linear control
- linear path control
- linearity control
- load control
- load-frequency control
- local control
- local-area control
- logic control
- lubricating oil level control
- machine control
- machine programming control
- machine shop control
- macro control
- magnetic control
- magnetic tape control
- main computer control
- malfunction control
- management control
- manual control
- manual data input control
- manual stop control
- manually actuatable controls
- manufacturing change control
- manufacturing control
- master control
- material flow control
- MDI control
- measured response control
- mechanical control
- memory NC control
- memory-type control
- metering control
- metrological control of production field
- microbased control
- microcomputer CNC control
- microcomputer numerical control
- microcomputer-based sequence control
- microprocessor control
- microprocessor numerical control
- microprogrammed control
- microprogramming control
- milling control
- model reference adaptive control
- model-based control
- moisture control
- motion control
- motor control
- motor speed control
- mouse-driven control
- movable control
- multicircuit control
- multidiameter control
- multilevel control
- multimachine tool control
- multiple control
- multiple-processor control
- multiposition control
- multistep control
- multivariable control
- narrow-band proportional control
- navigation control
- NC control
- neural network adaptive control
- noise control
- noncorresponding control
- noninteracting control
- noninterfacing control
- nonreversable control
- nonsimultaneous control
- numerical contouring control
- numerical control
- numerical program control
- odd control
- off-line control
- oligarchical control
- on-board control
- one-axis point-to-point control
- one-dimensional point-to-point control
- on-line control
- on-off control
- open loop control
- open loop manual control
- open loop numerical control
- open-architecture control
- operating control
- operational control
- operator control
- optical pattern tracing control
- optimal control
- optimalizing control
- optimizing control
- oral numerical control
- organoleptic control
- overall control
- overheat control
- override control
- p. b. control
- palm control
- parameter adaptive control
- parameter adjustment control
- partial d.o.f. control
- path control
- pattern control
- pattern tracing control
- PC control
- PC-based control
- peg board control
- pendant control
- pendant-actuated control
- pendant-mounted control
- performance control
- photoelectric control
- physical alignment control
- PIC control
- PID control
- plugboard control
- plug-in control
- pneumatic control
- point-to-point control
- pose-to-pose control
- position/contouring numerical control
- position/force control
- positional control
- positioning control
- positive control
- postprocess quality control
- power adaptive control
- power control
- power feed control
- power-assisted control
- powered control
- power-operated control
- precision control
- predictor control
- preselective control
- preset control
- presetting control
- pressbutton control
- pressure control
- preview control
- process control
- process quality control
- production activity control
- production control
- production result control
- programmable adaptive control
- programmable cam control
- programmable control
- programmable logic adaptive control
- programmable logic control
- programmable machine control
- programmable microprocessor control
- programmable numerical control
- programmable sequence control
- proportional plus derivative control
- proportional plus floating control
- proportional plus integral control
- prototype control
- pulse control
- pulse duration control
- punched-tape control
- purpose-built control
- pushbutton control
- quality control
- radio remote control
- radium control
- rail-elevating control
- ram stroke control
- ram-positioning control
- rapid-traverse controls for the heads
- rate control
- ratio control
- reactive control
- real-time control
- reduced-order control
- register control
- registration control
- relay control
- relay-contactor control
- remote control
- remote program control
- remote switching control
- remote valve control
- remote-dispatch control
- resistance control
- resolved motion rate control
- retarded control
- reversal control
- revolution control
- rigid-body control
- robot control
- robot perimeter control
- robot teach control
- rod control
- safety control
- sampled-data control
- sampling control
- schedule control
- SCR's control
- second derivative control
- selective control
- selectivity control
- self-acting control
- self-adaptive control
- self-adjusting control
- self-aligning control
- self-operated control
- self-optimizing control
- self-programming microprocessor control
- semi-automatic control
- sensitivity control
- sensor-based control
- sequence control
- sequence-type control
- sequential control
- series-parallel control
- servo control
- servo speed control
- servomotor control
- servo-operated control
- set value control
- shaft speed control
- shape control
- shift control
- shop control
- shower and high-pressure oil temperature control
- shut off control
- sight control
- sign control
- single variable control
- single-flank control
- single-lever control
- size control
- slide control
- smooth control
- software-based NC control
- softwared numerical control
- solid-state logic control
- space-follow-up control
- speed control
- stabilizing control
- stable control
- standalone control
- start controls
- static control
- station control
- statistical quality control
- steering control
- step-by-step control
- stepless control
- stepped control
- stick control
- stock control
- stop controls
- stop-point control
- storage assignment control
- straight cut control
- straight line control
- stroke control
- stroke length control
- supervisor production control
- supervisory control
- swarf control
- switch control
- symbolic control
- synchronous data link control
- table control
- tap-depth controls
- tape control
- tape loop control
- teach controls
- temperature control
- temperature-humidity air control
- template control
- tension control
- test control
- thermal control
- thermostatic control
- three-axis contouring control
- three-axis point-to-point control
- three-axis tape control
- three-mode control
- three-position control
- throttle control
- thumbwheel control
- time control
- time cycle control
- time optimal control
- time variable control
- time-critical control
- time-proportional control
- timing control
- token-passing access control
- tool life control
- tool run-time control
- torque control
- total quality control
- touch-panel NC control
- touch-screen control
- tracer control
- tracer numerical control
- trajectory control
- triac control
- trip-dog control
- TRS/rate control
- tuning control
- turnstile control
- two-axis contouring control
- two-axis point-to-point control
- two-dimension control
- two-hand controls
- two-position control
- two-position differential gap control
- two-step control
- undamped control
- user-adjustable override controls
- user-programmable NC control
- variable flow control
- variable speed control
- variety control
- varying voltage control
- velocity-based look-ahead control
- vise control
- vision responsive control
- visual control
- vocabulary control
- vocal CNC control
- vocal numerical control
- voltage control
- warehouse control
- washdown control
- water-supply control
- welding control
- wheel control
- wide-band control
- zero set control
- zoned track controlEnglish-Russian dictionary of mechanical engineering and automation > control
-
10 adjustment
1) регулировка, регулирование; настройка; установка3) выверка; юстировка5) коррекция6) геод. разбрасывание невязки7) оргтех. выравнивание ( в системе обработки текста)•to keep an instrument in adjustment — поддерживать прибор в рабочем (отрегулированном) состоянии;to remain in adjustment — сохранять юстировку; не подвергаться расстройке;adjustment when required — регулировка по мере надобностиadjustment of fundamental constants — согласование значений фундаментальных константadjustment of span — регулировка диапазонов (пределов) измерений-
actuating pressure adjustment
-
automatic adjustment
-
automatic web-tension adjustment
-
automatic widow adjustment
-
background tracking adjustment
-
backrest adjustment
-
balancing adjustment
-
bearing preload adjustment
-
bench adjustment
-
blade adjustment
-
brake adjustment
-
brake pedal linkage adjustment
-
cable-control adjustment
-
capacitance-balancing adjustment
-
carburetor altitude adjustment
-
centering adjustment
-
center adjustment
-
chain tension adjustment
-
clearance adjustment
-
clutch adjustment
-
coarse adjustment
-
cold valve adjustment
-
color purity adjustment
-
compass adjustment
-
continuous adjustment
-
controlled instrumental adjustment
-
coupler height adjustment
-
cyclostrophic adjustment
-
delayed adjustment
-
delicate adjustment
-
dial adjustment
-
discrete adjustment
-
dynamical adjustment
-
end play adjustment
-
error-feedback adjustment
-
exposure adjustment
-
fair adjustment
-
feedback adjustment
-
field adjustment
-
fine adjustment
-
flue-draft adjustment
-
frequency adjustment
-
gage adjustment
-
gap adjustment
-
geostrophic adjustment
-
gross adjustment
-
idle adjustment
-
impact adjustment
-
initial adjustment
-
internal adjustment
-
laser adjustment
-
least-squares adjustment
-
level adjustment
-
line adjustment
-
linkage actuation adjustment
-
manual adjustment
-
mesh adjustment
-
micrometer adjustment
-
minute adjustment
-
moisture adjustment
-
oil feed adjustment
-
on-line adjustment
-
periodic adjustment
-
phasing adjustment
-
plastic adjustment
-
power factor adjustment
-
preparatory adjustment
-
preset adjustment
-
press adjustment
-
purity adjustment
-
rate adjustment
-
register adjustment
-
roll adjustment
-
scale adjustment
-
screw adjustment
-
seat adjustment
-
sensitivity adjustment
-
service adjustment
-
settings adjustment
-
shading adjustment
-
shift point adjustment
-
slag adjustment
-
spatial adjustment
-
speed adjustment
-
spring adjustment
-
steering wheel adjustment
-
stress adjustment
-
tension adjustment
-
timing adjustment
-
track adjustment
-
tracking adjustment
-
travel adjustment
-
valve lash adjustment
-
vernier adjustment
-
waist adjustment
-
warm valve adjustment
-
weight adjustment
-
white adjustment
-
yoke adjustment
-
zero adjustment -
11 index
1) индекс; показатель; коэффициент || индексировать, помечать индексами, снабжать индексами; вчт. (с)формировать индекс3) указатель, стрелка ( измерительного прибора) || показывать5) (алфавитный или предметный) указатель, индекс || составлять( алфавитный или предметный) указатель6) полигр. (вырубленные) уступы ( на обрезе справочного издания)•-
acidity index
-
acoustoelectric index
-
adiabatic index
-
aggregate index
-
air pollution index
-
air quality index
-
amplitude modulation index
-
antecedent precipitation index
-
aridity index
-
array index
-
articulation index
-
asphalt penetration index
-
beam index
-
bell-position index
-
branching index
-
breaking index
-
burning index
-
caking index
-
capability utilization index
-
carbonization index of oil
-
catalog index
-
circulation index
-
citation index
-
cladding index of refraction
-
clayiness index
-
coke-quality index
-
coke-strength index
-
color index
-
cone index
-
consistency index
-
constraint index
-
core index of refraction
-
correction index
-
corrosion index
-
crown-area index
-
current index
-
current-noise index
-
curve index
-
cycle index
-
cylinder index
-
decontamination index
-
dense index
-
density index
-
deterioration index
-
diaphragm index
-
dielectric index
-
dielectric loss index
-
diesel index
-
dilatometer test index
-
directivity index
-
double bond index
-
drillability index
-
driving index
-
drum index
-
ductility index
-
dust index
-
ear height index
-
ecological sensitivity index
-
embrittlement index
-
emission index
-
environment quality index
-
extraordinary refraction index
-
extraordinary index
-
extreme values index
-
face shifting index
-
fine index
-
flow-behavior index
-
fractional index
-
fracture toughness index
-
free fluid index
-
go/no-go index
-
graded index
-
gravity index
-
grindability index
-
gross index
-
group refraction index
-
group index
-
gum inhibiting index
-
hardness index
-
hash index
-
hazard index
-
hydraulic index
-
hydrogen index
-
impurity index
-
index of absorption
-
index of cograduation
-
index of cooperation
-
index of correlation
-
index of dispersion
-
index of extinction
-
index of goodness
-
index of irrigation need
-
index of lens
-
index of moisture conditions
-
index of plasticity
-
index of refraction
-
index of root
-
index of thunderstorm activity
-
index of turbulence
-
index of wetness
-
infiltration index
-
injectivity index
-
inverted index
-
knock-limited density index
-
limiting viscosity index
-
loss index
-
machinability index
-
magnetic loss index
-
main index
-
mixing index
-
mode index
-
modified viscosity index
-
modulation index
-
moldability index
-
molding index
-
nondense index
-
oiliness index
-
optical index
-
ordinary refraction index
-
ordinary index
-
overall index
-
oversampling index
-
oxygen index
-
pattern correspondence index
-
perceived environmental quality index
-
performance index
-
permanganate index
-
permeability index
-
plasticity index
-
pluvial index
-
pollutional index
-
pollution index
-
porosity index
-
privacy index
-
probe index
-
processability index
-
producible oil index
-
productivity index
-
quality index
-
rainfall index
-
range index
-
reactivity index
-
reflection index
-
refraction index
-
reliability index
-
resistivity index
-
reversed index
-
reverse index
-
riding properties index
-
Roga index
-
roof quality index
-
salt index
-
scintillation index
-
secondary index
-
selection index
-
sharpness index
-
slagging index
-
snow accumulation index
-
stand density index
-
staple index
-
static reserve index
-
stepped index
-
step index
-
summation index
-
survival index
-
swelling index
-
throwing index
-
track index
-
traffic noise index
-
viscosity index
-
viscosity-temperature index
-
viscosity-zone index
-
volatility index
-
voltage index
-
vorticity area index
-
water pollution index
-
water quality index
-
wet grip index
-
winter severity index
-
word index
-
work-hardening index -
12 MCS
1) Общая лексика: hum. сокр. Multiple Chemical Sensitivities, hum. сокр. Multiple Cloning Site, (Major Case Squad) следственная группа по особо важным делам2) Компьютерная техника: Mini Control System, Minimal Common Supertype, Modify Comment Section, maritime communication service3) Геология: Mini Cooper S4) Морской термин: Marine Casualty Statistics5) Медицина: Mental Health Component summary, Mental Component Summary (индекс психологического здоровья)6) Ботаника: Moisture Control System7) Спорт: Motor Cross South8) Военный термин: Marine Corps System, Marine Corps school, Marine Corps station, Military Capabilities Study, Military Counterintelligence Service, Mine Countermeasures Support Ship, Mission Control Segment, maintenance control section, maintenance control system, maintenance cost system, management and control system, management computing service, master control station, master control system, mean crew size, message control system, microwave communications system, military communication station, millimeter-wave contrast seeker, mine countermeasures support, missile calibration station, missile checkout set, missile checkout station, missile commit sequence, missile control system, mobile checkout station, mobile communications squadron, mobile communications system, mobility, countermobility and survivability, modular communication system, movement control staff, multipurpose communications and signaling, multipurpose control set, (ACUS) Maneuver Control System (Area Common User System), Mounted Combat System9) Техника: Mediterranean communications system, Monte Carlo sampling, main circulator subsystem, mapping camera system, maritime communications service, measurements calibration system, medium dose shot, megacycle per second, microwave carrier supply, military communications station, mineral cations saturation, monitor and control system, multiprocessor computer system10) Сельское хозяйство: Multiple Compression Shear11) Шутливое выражение: Messy Crackpot Service12) Юридический термин: Monitoring, Control and Surveillance13) Бухгалтерия: Management Consulting Services14) Автомобильный термин: mixture control solenoid (GM)15) Музыка: Music Chord System16) Телекоммуникации: Multipoint Communication Service17) Сокращение: Machinery Control System, Maneuver Computing System (USA), Maneuver Control System (USA), Maneuver Control System, Master Control Set, Master of Commercial Science, Master of Computer Science, Micro-Climate Conditioning System, Military College of Science, Military Communications Systems, Mine Countermeasures command, control & support Ship (US Navy), Mobile Camouflage System (Australian Army), Mobile Camouflage System, Mobile Control Station, Modular Charge System, Multi-media Communications Station18) Университет: Mathematical And Computer Sciences19) Физиология: Multiple Chemical Sensitivity20) Электроника: Material Control System21) Вычислительная техника: Message Conversion System, Micro Computer Systems, Microsoft Cluster Server, MultiCast Server, Modulation and Coding Scheme (EGPRS, Mobile-Systems), Multichannel Communications System (Mac)22) Нефть: motor control stations23) Космонавтика: система управления движением25) Транспорт: Monitor and Control Software, Motor Carrier Safety26) Деловая лексика: Multimedia Conferencing System27) Менеджмент: master control schedule28) Полимеры: megacycles per second, monochlorostyrene29) Автоматика: machine control system, man-computer system, multiple character set30) Телефония: Media Convergence Server31) Океанография: Mesoscale Convective System, Molluscs Can't Swim33) Должность: Management Computer Systems, Master Of Christian Studies34) NYSE. Marcus Corporation -
13 mcs
1) Общая лексика: hum. сокр. Multiple Chemical Sensitivities, hum. сокр. Multiple Cloning Site, (Major Case Squad) следственная группа по особо важным делам2) Компьютерная техника: Mini Control System, Minimal Common Supertype, Modify Comment Section, maritime communication service3) Геология: Mini Cooper S4) Морской термин: Marine Casualty Statistics5) Медицина: Mental Health Component summary, Mental Component Summary (индекс психологического здоровья)6) Ботаника: Moisture Control System7) Спорт: Motor Cross South8) Военный термин: Marine Corps System, Marine Corps school, Marine Corps station, Military Capabilities Study, Military Counterintelligence Service, Mine Countermeasures Support Ship, Mission Control Segment, maintenance control section, maintenance control system, maintenance cost system, management and control system, management computing service, master control station, master control system, mean crew size, message control system, microwave communications system, military communication station, millimeter-wave contrast seeker, mine countermeasures support, missile calibration station, missile checkout set, missile checkout station, missile commit sequence, missile control system, mobile checkout station, mobile communications squadron, mobile communications system, mobility, countermobility and survivability, modular communication system, movement control staff, multipurpose communications and signaling, multipurpose control set, (ACUS) Maneuver Control System (Area Common User System), Mounted Combat System9) Техника: Mediterranean communications system, Monte Carlo sampling, main circulator subsystem, mapping camera system, maritime communications service, measurements calibration system, medium dose shot, megacycle per second, microwave carrier supply, military communications station, mineral cations saturation, monitor and control system, multiprocessor computer system10) Сельское хозяйство: Multiple Compression Shear11) Шутливое выражение: Messy Crackpot Service12) Юридический термин: Monitoring, Control and Surveillance13) Бухгалтерия: Management Consulting Services14) Автомобильный термин: mixture control solenoid (GM)15) Музыка: Music Chord System16) Телекоммуникации: Multipoint Communication Service17) Сокращение: Machinery Control System, Maneuver Computing System (USA), Maneuver Control System (USA), Maneuver Control System, Master Control Set, Master of Commercial Science, Master of Computer Science, Micro-Climate Conditioning System, Military College of Science, Military Communications Systems, Mine Countermeasures command, control & support Ship (US Navy), Mobile Camouflage System (Australian Army), Mobile Camouflage System, Mobile Control Station, Modular Charge System, Multi-media Communications Station18) Университет: Mathematical And Computer Sciences19) Физиология: Multiple Chemical Sensitivity20) Электроника: Material Control System21) Вычислительная техника: Message Conversion System, Micro Computer Systems, Microsoft Cluster Server, MultiCast Server, Modulation and Coding Scheme (EGPRS, Mobile-Systems), Multichannel Communications System (Mac)22) Нефть: motor control stations23) Космонавтика: система управления движением25) Транспорт: Monitor and Control Software, Motor Carrier Safety26) Деловая лексика: Multimedia Conferencing System27) Менеджмент: master control schedule28) Полимеры: megacycles per second, monochlorostyrene29) Автоматика: machine control system, man-computer system, multiple character set30) Телефония: Media Convergence Server31) Океанография: Mesoscale Convective System, Molluscs Can't Swim33) Должность: Management Computer Systems, Master Of Christian Studies34) NYSE. Marcus Corporation -
14 tester
2) щуп; зонд3) испытательное устройство; испытательный стенд5) испытатель; лаборант•- back-to-back torque tester
- bevel gear tester
- Brinell hardness tester
- compression tester
- concentricity tester
- connectivity tester
- cutter angle tester
- deadweight pressure gage tester
- digital hardness tester
- distortion tester
- double-flank gear rolling tester
- eddy-current tester
- gear pitch tester
- gear tester
- general purpose tester
- hardness tester
- hypoid tester
- insulation tester
- involute tester
- moisture tester
- phasing tester
- portable hardness tester
- Rockwell hardness tester
- sensitivity tester
- servomechanism tester
- Shore hardness tester
- Super-Rockwell hardness tester
- system tester
- tensile tester
- tooth-pacing tester
- universal hardness tester
- variable-center-distance gear-rolling tester
- Vickers hardness testerEnglish-Russian dictionary of mechanical engineering and automation > tester
-
15 automatic
автоматический аппарат; II автоматический; самодействующий; автоматизированный- automatic acceleration control unit - automatic accumulator charging - automatic action - automatic adjustment - automatic adjustment mechanism - automatic advance control - automatic air regulator - automatic alarm - automatic alarm signal transmitter - automatic alternation - automatic amplitude control - automatic arc welding - automatic arc welding machine - automatic arc-welding machine - automatic assemblage - automatic assembly - automatic assembly machine - automatic backing-up - automatic backlash control - automatic backup - automatic balance control - automatic balancer - automatic balancing - automatic bar fed turning center - automatic bar feed - automatic bias control - automatic block - automatic bonding unit - automatic brake - automatic brake adjuster - automatic brake arrangement - automatic brake controller - automatic braking - automatic braking system - automatic brazing equipment - automatic buffing machine - automatic burette - automatic butt splicer - automatic calibration - automatic cam-controlled machine - automatic cathead - automatic centering - automatic chain-bending machine - automatic change of tools - automatic change-over - automatic change-over switch - automatic check - automatic check-out recording equipment - automatic checking balance - automatic checking machine - automatic checkout equipment - automatic checkout system - automatic checkout-and-readiness equipment - automatic choke - automatic chuck - automatic chuck extractor - automatic chuck-changing system - automatic chuck jaw changing - automatic chucker - automatic circuit - automatic circuit breaker - automatic circuit recloser - automatic climate control system - automatic closing system - automatic clutch - automatic cold upsetter - automatic come-along clamp - automatic compensation option - automatic compensator - automatic consistency checking - automatic constant tension mooring winch - automatic control - automatic control actuator - automatic control channel - automatic control circuit - automatic control engineering - automatic control equipment - automatic control halting instruction - automatic control installation - automatic control loop - automatic control rod - automatic control system - automatic controller - automatic conveying - automatic coupler - automatic coupling - automatic coupling device - automatic coupling screwing unit - automatic crab winch - automatic crimper - automatic crossover - automatic cut-out torque wrench - automatic cutout - automatic cycle - automatic cycle mechanism - automatic cycle working - automatic cycling equipment - automatic data analyzer - automatic data distribution - automatic data entry - automatic data processing - automatic data processing field branch - automatic data unit - automatic datum search - automatic deicing system - automatic device - automatic diagnosis - automatic diagnostic-and-recovery system - automatic discharging device - automatic disk changer - automatic door - automatic door closer - automatic door photoelectric relay - automatic drilling control - automatic drilling rig - automatic drinking bowl - automatic drive - automatic drive detection - automatic drive engagement - automatic dump - automatic-dump truck - automatic dust ejector - automatic dust unloading valve - automatic ejection - automatic electric drive - electrical drive - automatic electrode changer - automatic elevator - automatic emergency valve - automatic end stop - automatic error correction - automatic error detection - automatic exchange of tools - automatic expansion valve - automatic fault detection - automatic fault finding - automatic fault isolation - automatic fault isolation tester - automatic fault reporting - automatic fault signalling - automatic feature - automatic feed - automatic feed drill - automatic feed-off mechanism - automatic feeder - automatic feeding mechanism - automatic feedoff - automatic fire alarm - automatic fire alarm system - automatic fire annunciator - automatic fire detector - automatic fire sprinkler - automatic fixturing system - automatic flanger - automatic float-type pump-out unit - automatic flour meter - automatic flow tank - automatic focus correction servo-system - automatic forging machine - automatic front wheel drive engagement - automatic fuel economizing device - automatic fuel-control unit - automatic fuel saving device - automatic fuel shut-off - automatic fuse - automatic gage - automatic gaging-and-compensating system - automatic gain adjustment - automatic gain control - automatic gas-cutting machine - automatic gas-welding machine - automatic gate - automatic gate closer - automatic gate opener - automatic gauging - automatic gearbox - automatic generating plant - automatic generator - automatic grab - automatic gripper change - automatic gripper control - automatic guided vehicle - automatic half-hose machine - automatic heater - automatic hill holder - automatic hinged trip spider - automatic hitch - automatic holding - automatic holding device - automatic hopper-feed machine - automatic humidity regulator - automatic identification- Auto-ID- AIS - automatic idling control - automatic ignition - automatic ignition system - automatic ignition timing - automatic input - automatic insertion - automatic interlocking - automatic internal diagnosis - automatic jaw changer - automatic jaw shift device - automatic latching - automatic level - automatic level compensation - automatic level control - automatic level control system - automatic level gauge - automatic level setup - automatic leveling control system - automatic light - automatic light control - automatic light regulation - automatic line - automatic line disconnection - automatic line switching - ALS - automatic load control - automatic load sustaining brake - automatic load-gripping device - automatic loader - automatic loading - automatic lock - automatic locking - automatic locking holder - automatic locking hub - automatic locking spindle - automatic lockout - automatic lockout feature - automatic lubrication - automatic lubricator - automatic machine cycle - automatic magazine bar feed - automatic maintenance - automatic manipulator - automatic measurement-and-compensation system - automatic measuring facilities - automatic metal forming machine - automatic mixture control - automatic mode switching - automatic moisture regulator - automatic monitoring - automatic motor control gear - automatic movements starting - automatic multicam machine - automatic noise limiter - automatic noise-reduction system - automatic oil-flow controller - automatic oiling - automatic opening circuit breaker - automatic opening cover - automatic optimization - automatic overload control - automatic overload limiter - automatic overload stop - automatic packing - automatic pallet handler - automatic pallet storage-retrieval system - automatic part gaging - automatic part-loading conveyor - automatic photodetector - automatic pipe handling system - automatic pipe stabber - automatic placement - automatic plant - automatic polishing machine - automatic positioning - automatic power control - automatic power drawbar control - automatic power rotary scraper - automatic power slips - automatic press for cold pressing of nuts - automatic press for stamping electric motor stator and rotor notches - automatic pressure control - automatic pressure regulator - automatic probe changer - automatic probe changing - automatic probing cycle - automatic punch - automatic rack stacker - automatic radiator shutter - automatic ram pile driver - automatic reading - automatic reclosing circuit breaker - automatic recovery - automatic recovery program - automatic regulation - automatic regulation of belt tension - automatic regulation of drive chain tension - automatic regulation rod - automatic regulator - automatic release - automatic releaser - automatic repeat - automatic remote control - automatic reset - automatic reset-data circuit - automatic restart - automatic return - automatic return valve - automatic rotary line - automatic router - automatic routine - automatic rpm changer - automatic safety device - automatic sample changer - automatic sampler - automatic sampling - automatic sampling device - automatic sampling equipment - automatic sand-blasting machine - automatic scales - automatic screen - automatic selective overdrive - automatic sensitivity control - automatic set point - automatic shaft-position data encoder - automatic shaker bag - automatic shank spindle - automatic shift - automatic shut-off valve - automatic shutdown - automatic side-dumping - automatic signaling - automatic signalization - automatic size control tooling - automatic sorting machine - automatic spark advance - automatic spark advance governor - automatic spark advance magneto - automatic spark timer - automatic spectrometer - automatic spectrophotometer - automatic speed compensation - automatic speed control - automatic speed selection device - automatic spider - automatic spindle gear changing - automatic sprinkler fire control system - automatic stability - automatic stability controls - automatic stabilization and control system - automatic stabilizer - automatic stacker crane - automatic start - automatic starting - automatic starting motor - automatic start-up - automatic steel - automatic steering - automatic step selection - automatic stop - automatic stop switch - automatic straightening and cutting machine - automatic strip-straightening machine - automatic submerged-arc welder - automatic submerged-arc welding - automatic sucker rod spanner - automatic suction pump - automatic surveillance - automatic switch - automatic switchable redundance - automatic switchboard - automatic swivel spindle - automatic synchronization - automatic synchronizer - automatic takeup - automatic takeup mechanism - automatic temperature recording controller - automatic temperature regulator - automatic tensioning winch - automatic test analysis system - automatic test equipment - automatic test system - automatic thrust adjustment - automatic time switch - automatic time-delay switch - automatic timed magneto - automatic timer - automatic timing - automatic timing control - automatic timing device - automatic tipper - automatic tool changing apparatus - automatic tool transport mechanism - automatic tool wear-tool broken sensing system - automatic toolsetting - automatic tongs - automatic training idler - automatic transmission - automatic transmission fluid - automatic trip - automatic troubleshooting - automatic tuning - automatic two-speed geared head - automatic update - automatic vacuum deposition system - automatic valve - automatic valve adjustment - automatic viscosity controller - automatic voltage control - automatic voltage regulator - automatic warehousing - automatic warning - automatic washer - automatic water bowl - automatic water spray fire-fighting system - automatic weight controller - automatic weighing machine - automatic weigher - automatic weld - automatic welder - automatic welding - automatic welding machine - automatic wire feed - automatic workhandling - automatic workhandling device - automatic zero adjustment - automatic zero set -
16 control
управление; регулирование; контроль; орган [рычаг] управления; руль; pl. система управления или регулирования; управлять; регулироватьback seat flight control — управление ЛА из задней кабины [с места заднего лётчика]; pl. дублирующие органы управления в задней кабине
be out of control — терять управление [управляемость]; выходить из-под управления [контроля]
continuously variable thrust control — плавное [бесступенчатое] регулирование тяги
control c.g. control — регулирование центровки (ЛА)
control of missile attitude — стабилизация ракеты; управление пространственным положением ракеты
control of the air — превосходство или господство в воздухе; превосходство в области авиации [в авиационной технике]; контроль воздушного пространства
control of the yoke — разг. управление штурвалом
control of thrust orientation — управление ориентированием [направлением вектора] тяги
flight deck lighting controls — органы управления [ручки регулировки] освещением кабины экипажа
fling the controls over — перебрасывать органы управления (в противоположную сторону),
flow control with altitude compensation — регулятор расхода [подачи] с высотным корректором
fuel dump valve control — кран [рычаг крана] аварийного слива топлива
gas jet attitude control — управление пространственным положением с помощью системы газоструйных рулей
go out of control — терять управление, выходить из-под управления [контроля]
ground rollout rudder steering control — управление пробегом [на пробеге] с помощью руля направления
interconnected fuel and propeller controls — объединённая система регулирования подачи топлива и шага винта
jet tab thrust vector control — управление вектором тяги с помощью газовых рулей; дефлекторное управление вектором тяги
jet(-deflection, -direction) control — реактивное [струйное] управление; управление изменением направления тяги; струйный руль
manual mixture shut-off control — рычаг отсечки подачи горючей смеси, рычаг останова [выключения] двигателя
maximum boundary layer control — управление пограничным слоем при наибольшей эффективности [производительности, интенсивности работы] системы
recover the control — восстанавливать управление [управляемость]
respond to the controls — реагировать [отвечать] на отклонение рулей [органов управления]
space shuttle orbiter control — управление орбитальной ступенью челночного воздушно-космического аппарата
throttle and collective pitch control — верт. рычаг «шаг — газ»
См. также в других словарях:
Moisture Sensitivity Level — relates to the packaging and handling precautions for some semiconductors. The MSL is an electronic standard for the time period in which a moisture sensitive device can be exposed to ambient room conditions (approximately 30°C/60%RH).… … Wikipedia
Moisture Sensitivity Level — Der Moisture Sensitivity Level (MSL, dt. »Feuchtigkeitsempfindlichkeitsschwellwert«) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen bei der Verpackung, Lagerung und Montage. Hintergrund Kunststoffumspritzte SMD Bauelemente … Deutsch Wikipedia
Moisture Sensitive Level — Der Moisture Sensitivity Level (MSL, dt. »Feuchtigkeitsempfindlichkeitsschwellwert«) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen bei der Verpackung, Lagerung und Montage. Inhaltsverzeichnis 1 Hintergrund 2… … Deutsch Wikipedia
Antecedent moisture — is a term from the fields of Hydrology and sewage collection and disposal that describes the relative wetness or dryness of a watershed or sanitary sewershed. Antecedent moisture conditions change continuously and can have a very significant… … Wikipedia
Occam Process — The Occam Process is a solder free, Restriction of Hazardous Substances Directive (RoHS) compliant method for use in the manufacturing of electronic circuit boards and was developed by Verdant Electronics. It combines the usual two steps of the… … Wikipedia
Percussion cap — The percussion cap, introduced around 1830, was the crucial invention that enabled muzzle loading firearms to fire reliably in any weather. Before this development, firearms used flintlock ignition systems which produced flint on steel sparks to… … Wikipedia
Ionic liquid — An ionic liquid is a liquid that contains essentially only ions. Some ionic liquids, such as ethylammonium nitrate are in a dynamic equilibrium where at any time more than 99.99% of the liquid is made up of ionic rather than molecular species. In … Wikipedia
MSL — The acronym MSL may mean *Major Series Lacrosse *Major Soccer League *Malaysian Sign Language *Malaysian Super League *Mars Science Laboratory *Multimedia and Sensors Laboratory at Georgia Tech *Master of Studies in Law, a master s degree offered … Wikipedia
Restriction of Hazardous Substances Directive — European Union directive: Directive 2002/95/EC Directive on the restriction of the use of certain hazardous substances in electrical and electronic equipment Made by Council Parliament … Wikipedia
Explosive material — A number of 1.25lb M112 Demolition Charges, consisting of a C 4 compound, sit atop degraded weaponry scheduled for destruction An explosive material, also called an explosive, is a reactive substance that contains a great amount of potential… … Wikipedia
Dry rot treatment — refers to the techniques used to eliminate dry rot fungus and alleviate the damage done by the fungus to human built wooden structures. The commonly held view of an outbreak of the dry rot fungus (Serpula lacrymans) within a building is that it… … Wikipedia